General Information

  • ID:  hor006425
  • Uniprot ID:  P51455
  • Protein name:  Relaxin B chain
  • Gene name:  RNL2
  • Organism:  Pan troglodytes (Chimpanzee)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed in the corpus luteum of pregnancy and in the placenta.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DSWMDEVIKLCGRELVRAQIAICGKSTWS
  • Length:  29(6-34)
  • Propeptide:  SRAVADSWMDEVIKLCGRELVRAQIAICGKSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQYVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC
  • Signal peptide:  SRAVA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51455-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006425_AF2.pdbhor006425_ESM.pdb

Physical Information

Mass: 379547 Formula: C143H232N40O43S3
Absent amino acids: FHNPY Common amino acids: IS
pI: 6.35 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: 0 Boman Index: -4256
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 94.14
Instability Index: 1049.66 Extinction Coefficient cystines: 11125
Absorbance 280nm: 397.32

Literature

  • PubMed ID:  8182365
  • Title:  Characterization of two relaxin genes in the chimpanzee.
  • PubMed ID:  8735594
  • Title:  Expression of human relaxin genes: characterization of a novel alternatively-spliced human relaxin mRNA species.